General Information

  • ID:  hor001907
  • Uniprot ID:  Q60549
  • Protein name:  Somatoliberin
  • Gene name:  GHRH
  • Organism:  Mesocricetus auratus (Golden hamster)
  • Family:  Glucagon family
  • Source:  animal
  • Expression:  hypothalamus
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mesocricetus (genus), Cricetinae (subfamily), Cricetidae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0032879 regulation of localization
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YADAIFTSSYRKVLGQLSARKLLQDIMSRQQGERNQEQGPRVRL
  • Length:  44
  • Propeptide:  MPLWVFFVILTLTNGSHCSPSPSLPFRIRRYADAIFTSSYRKVLGQLSARKLLQDIMSRQQGERNQEQGPRVRLGRQVDSMWADHRQMSLESLLAALLQKHSRDSQG
  • Signal peptide:  MPLWVFFVILTLTNGSHCS
  • Modification:  T44 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Acts on the adenohypophyse to stimulate the secretion of growth hormone
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P30990-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P30990-F1.pdbhor001907_AF2.pdbhor001907_ESM.pdb

Physical Information

Mass: 587598 Formula: C220H365N71O67S
Absent amino acids: CHW Common amino acids: QR
pI: 10.91 Basic residues: 8
Polar residues: 11 Hydrophobic residues: 13
Hydrophobicity: -82.05 Boman Index: -13191
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 82.05
Instability Index: 5122.27 Extinction Coefficient cystines: 2980
Absorbance 280nm: 69.3

Literature

  • PubMed ID:  NA
  • Title:  NA